PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g072310.2.1
Common NameLOC101246729
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 718aa    MW: 78653.3 Da    PI: 6.6208
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g072310.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.41.2e-183586556
                        SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        +++t++q++ Le++F+++++p+++ r +L++ lgL  rq+k+WFqNrR++ k
  Solyc06g072310.2.1 35 HRHTAHQIQSLESVFKECPHPDEKIRLQLSRDLGLAPRQIKFWFQNRRTQLK 86
                        689*********************************************9987 PP

2START171.36.5e-542284532206
                         HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
               START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         +a  a++el+++ + +ep+W+ks     + ++ d++ q+f+++++       ++ea+r sgvv+m+   lv  ++d++ +W e ++    k
  Solyc06g072310.2.1 228 IAGNAMEELIRLLQTNEPLWTKSTtdgrDVLDIDKYGQIFPKANSslknpnVRVEASRQSGVVIMNGLALVDMFMDVN-KWVEFFPtivsK 317
                         67899**********************99***********99999*********************************.************ PP

                         EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEE CS
               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                         a tlevis g      ++lqlm+ae q+lsplvp R  +f+R+++q + g+w+ivdvS d +q++   +s+ ++++lpSg+li++++ng+s
  Solyc06g072310.2.1 318 ARTLEVISCGmmgsrsSTLQLMYAEQQVLSPLVPtRQLYFLRFCQQIETGSWAIVDVSYDITQENMYPPSSCKVHKLPSGCLIQDMPNGYS 408
                         ***************************************************************998899********************** PP

                         EEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 163 kvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                         kvtw+ehv+++++   h l+r l+ sg+a+ga +w+  lqr+ce+
  Solyc06g072310.2.1 409 KVTWLEHVEVEEKGSiHRLYRDLIFSGMAFGAERWLGSLQRLCER 453
                         **********998666***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.09E-181588IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-201782IPR009057Homeodomain-like
PROSITE profilePS5007117.1672888IPR001356Homeobox domain
SMARTSM003892.1E-182992IPR001356Homeobox domain
CDDcd000861.26E-173089No hitNo description
PfamPF000462.8E-163586IPR001356Homeobox domain
PROSITE patternPS0002706386IPR017970Homeobox, conserved site
PROSITE profilePS5084848.053218456IPR002913START domain
SuperFamilySSF559611.24E-35219455No hitNo description
CDDcd088753.58E-112222452No hitNo description
SMARTSM002342.0E-43227453IPR002913START domain
PfamPF018528.4E-46228453IPR002913START domain
Gene3DG3DSA:3.30.530.204.4E-5233263IPR023393START-like domain
Gene3DG3DSA:3.30.530.204.4E-5336426IPR023393START-like domain
SuperFamilySSF559611.31E-20474683No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009828Biological Processplant-type cell wall loosening
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 718 aa     Download sequence    Send to blast
MEYGGGGGGG GGGGGASSSG GGDATDASRK KKRFHRHTAH QIQSLESVFK ECPHPDEKIR  60
LQLSRDLGLA PRQIKFWFQN RRTQLKSQHE RADNSALRSE NDRIRCENIA IREAIKNVIC  120
PSCGGPPVTE DTYFDEQKLR MENLQLKEEL DKISSIAAKY MGRPISQLPP VQPVHLSSLN  180
LMSMPNFGLT GPSLDLDLLP GSSTSTYPNL PCPTFNISDM DKSLMADIAG NAMEELIRLL  240
QTNEPLWTKS TTDGRDVLDI DKYGQIFPKA NSSLKNPNVR VEASRQSGVV IMNGLALVDM  300
FMDVNKWVEF FPTIVSKART LEVISCGMMG SRSSTLQLMY AEQQVLSPLV PTRQLYFLRF  360
CQQIETGSWA IVDVSYDITQ ENMYPPSSCK VHKLPSGCLI QDMPNGYSKV TWLEHVEVEE  420
KGSIHRLYRD LIFSGMAFGA ERWLGSLQRL CERYACLMVS GNSSRELGGV IPSPEGKKSM  480
MKVAERMVSS FCASINPSNG HQWNNISTLD EFEVRATLQK CTDPGQPNGV VISAASTIWL  540
PVPPQHVFNF LRDERTRPQW DVLSNQNPVQ EVAHIANGSH PGNSISVLRA YNTSQNNMLI  600
LQESCIDSSG SLVVYSPVDL QSINIAMSGE DTTYIPLLPS GFTISPDGRG SDEALSMNNG  660
STMRAGGGGS LVTVVFQILV SSLSSSAKMS PESVNTVNNL IGNTIHQIKA ALNCSTS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00232DAPTransfer from AT1G73360Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004241474.10.0PREDICTED: homeobox-leucine zipper protein HDG11-like
SwissprotQ9FX310.0HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLK4C8V10.0K4C8V1_SOLLC; Uncharacterized protein
STRINGSolyc06g072310.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24902351
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]